General Information

  • ID:  hor005692
  • Uniprot ID:  A0A0F7YZQ7
  • Protein name:  Elevenin-Vc1
  • Gene name:  NA
  • Organism:  Conus victoriae (Queen Victoria cone)
  • Family:  NA
  • Source:  Animal
  • Expression:  Expressed by the venom duct.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Cylinder (subgenus), Conus (genus), Conidae (family), Conoidea (superfamily), Neogastropoda (order), Caenogastropoda (subclass), Gastropoda (class), Mollusca (phylum), Lophotrochozoa, Spiralia, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0090729 toxin activity
  • GO BP:  GO:0035821 modulation of process of another organism
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  RRIDCKVFVFAPICRGVAA
  • Length:  19(25-43)
  • Propeptide:  MAPSQKALLVLVLSMLLTASDSWARRIDCKVFVFAPICRGVAAKRGGDSLSVGGSAELDDALTDPFLRSEEPREWRELTRLSRVLQTFLSHPTGETEQHD
  • Signal peptide:  MAPSQKALLVLVLSMLLTASDSWA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  45791
  • Structure ID:  AF-A0A0F7YZQ7-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005692_AF2.pdbhor005692_ESM.pdb

Physical Information

Mass: 244285 Formula: C95H157N29O22S2
Absent amino acids: EHLMNQSTWY Common amino acids: ARV
pI: 9.91 Basic residues: 4
Polar residues: 3 Hydrophobic residues: 10
Hydrophobicity: 77.37 Boman Index: -2218
Half-Life: 1 hour Half-Life Yeast: 2 min
Half-Life E.Coli: 2 min Aliphatic Index 102.63
Instability Index: 4082.11 Extinction Coefficient cystines: 125
Absorbance 280nm: 6.94

Literature

  • PubMed ID:  24505301
  • Title:  Diversity of conotoxin gene superfamilies in the venomous snail, Conus victoriae.
  • PubMed ID:  26301480
  • Title:  Hormone-like peptides in the venoms of marine cone snails.